LL-37 5mg Peptide

(4 customer reviews)

£34.95

LL-37 5mg is a high-purity antimicrobial research peptide supplied as a lyophilised solid for stability. Verified at >99.1% purity (HPLC-tested) with full COA provided, it is studied in models of immune response, wound healing, and antimicrobial activity. LL-37, part of the Cathelicidin peptide family, has shown antimicrobial, antibacterial, antiviral, and antifungal properties in research models. It has also been explored for its anti-inflammatory potential and ability to support angiogenesis and cellular repair in specific biological settings. Intended strictly for research use only.

View Certificate of Analysis

Buy 5 and save 5%
Buy 10 and save 8%
Buy 25 and save 12%

Discount applied automatically at checkout

Out of stock

SKU: BWP-LL37-5 Categories: , Brand:
Add £77.01 more to get free shipping!

LL-37 5mg – High-Purity Antimicrobial Research Peptide

LL-37 (also known as CAP-18) is a synthetic antimicrobial peptide belonging to the cathelicidin family, widely studied in preclinical research for its immune-modulating, antibacterial, antiviral, and tissue-repair properties. Supplied in lyophilised (freeze-dried) form for maximum stability, this compound is verified at >99.1% purity (HPLC-tested) and includes a full Certificate of Analysis (COA).


What is LL-37?

LL-37 is a naturally occurring peptide fragment derived from the human cathelicidin antimicrobial protein (hCAP-18). Researchers have investigated LL-37 for its role in innate immunity, inflammation regulation, and cellular regeneration.

Bluewell Peptides supplies LL-37 strictly for laboratory research use only, ensuring each batch is tested and verified for purity, stability, and composition transparency.


Scientific Identifiers

  • Product Name: LL-37 5mg

  • Catalogue Number: BWP-LL37-5

  • CAS Number: 154947-66-7

  • Molecular Formula: C₂₀₃H₃₄₅N₆₁O₄₉S

  • Molecular Weight: 4493.34 g/mol

  • Sequence: [LL-37, 37 aa]

  • Form: Lyophilised Solid

  • Purity: >99.1% (HPLC Verified)

  • Storage: Store at −20°C, protected from light

  • Unit Size: 5mg


Usage and Reconstitution

LL-37 is supplied as a lyophilised solid for stability during storage and transport. For laboratory use, it may be reconstituted with bacteriostatic water or other appropriate solvents under aseptic conditions. Refer to our peptide reconstitution page for full guidance.


Research Applications of LL-37

LL-37 has been investigated in preclinical studies for its potential influence on:

  • Antimicrobial Defence – Studied for its broad-spectrum antibacterial, antiviral, and antifungal properties.

  • Wound Healing and Tissue Repair – Explored for its potential to stimulate angiogenesis and cellular regeneration.

  • Immune Regulation – Researched for its ability to modulate inflammatory pathways and immune cell recruitment.

  • Cancer and Regenerative Studies – Investigated for its potential role in tumour suppression and tissue regeneration models.

References available upon request or via our research archive.


Why Order LL-37 from Bluewell Peptides?

  • 99.1% purity, HPLC-verified

  • COA provided with every batch

  • Secure ordering and fast UK delivery

  • Transparent, research-focused supplier

  • Excellent customer support and trusted reviews


Legal and Safety Information

Bluewell Peptides products are supplied strictly for laboratory research and educational purposes only. They are not approved for human or veterinary use. These compounds are not intended to diagnose, treat, cure, or prevent any disease. Use must comply with all applicable laws and regulations.

Certificate of analysis (COA)

LL-37 Bluewell Peptides Certificate of analysis Report

4 reviews for LL-37 5mg Peptide

  1. 5
    (4 customer reviews)
    100% of customers recommend this product.
    5 Stars100%4 Stars0%3 Stars0%2 Stars0%1 Star0%
  2. NEO

    High quality product. Felt like my defences were stronger during a hectic month.

    0 of 0 found this review helpful
  3. Crt79

    No complaints here

    Pure for sure! noticed benefits fairly quick

    0 of 0 found this review helpful
  4. Customer428

    .

    0 of 0 found this review helpful
  5. Ryan

    Interesting peptide

    Seems to genuinely support the immune system, kind of like a natural defence molecule. I’ve noticed I recover faster from little things like colds or fatigue, and overall just feel more resilient. It’s not some instant miracle, but after a couple of weeks it’s clear this stuff actually does something.

    0 of 0 found this review helpful
Add a review

Your email address will not be published. Required fields are marked *

Lab-Tested Quality

All Bluewell products are batch-tested with full COAs available, ensuring unmatched purity and consistency.

Next-Day Delivery

Order by 3PM for tracked next-day delivery across the UK. Cold-safe shipping on all peptides.

Scientific-Grade Purity

Over 99.1% purity, sterile lyophilised powder, manufactured to ISO-certified research standards.

Fast Researcher Support

Expert help with storage, reconstitution, dosing, and handling whenever you need it.