LL-37 5mg – High-Purity Antimicrobial Research Peptide
LL-37 (also known as CAP-18) is a synthetic antimicrobial peptide belonging to the cathelicidin family, widely studied in preclinical research for its immune-modulating, antibacterial, antiviral, and tissue-repair properties. Supplied in lyophilised (freeze-dried) form for maximum stability, this compound is verified at >99.1% purity (HPLC-tested) and includes a full Certificate of Analysis (COA).
What is LL-37?
LL-37 is a naturally occurring peptide fragment derived from the human cathelicidin antimicrobial protein (hCAP-18). Researchers have investigated LL-37 for its role in innate immunity, inflammation regulation, and cellular regeneration.
Bluewell Peptides supplies LL-37 strictly for laboratory research use only, ensuring each batch is tested and verified for purity, stability, and composition transparency.
Scientific Identifiers
-
Product Name: LL-37 5mg
-
Catalogue Number: BWP-LL37-5
-
CAS Number: 154947-66-7
-
Molecular Formula: C₂₀₃H₃₄₅N₆₁O₄₉S
-
Molecular Weight: 4493.34 g/mol
-
Sequence: [LL-37, 37 aa]
-
Form: Lyophilised Solid
-
Purity: >99.1% (HPLC Verified)
-
Storage: Store at −20°C, protected from light
-
Unit Size: 5mg
Usage and Reconstitution
LL-37 is supplied as a lyophilised solid for stability during storage and transport. For laboratory use, it may be reconstituted with bacteriostatic water or other appropriate solvents under aseptic conditions. Refer to our peptide reconstitution page for full guidance.
Research Applications of LL-37
LL-37 has been investigated in preclinical studies for its potential influence on:
-
Antimicrobial Defence – Studied for its broad-spectrum antibacterial, antiviral, and antifungal properties.
-
Wound Healing and Tissue Repair – Explored for its potential to stimulate angiogenesis and cellular regeneration.
-
Immune Regulation – Researched for its ability to modulate inflammatory pathways and immune cell recruitment.
-
Cancer and Regenerative Studies – Investigated for its potential role in tumour suppression and tissue regeneration models.
References available upon request or via our research archive.
Why Order LL-37 from Bluewell Peptides?
-
99.1% purity, HPLC-verified
-
COA provided with every batch
-
Secure ordering and fast UK delivery
-
Transparent, research-focused supplier
-
Excellent customer support and trusted reviews
Legal and Safety Information
Bluewell Peptides products are supplied strictly for laboratory research and educational purposes only. They are not approved for human or veterinary use. These compounds are not intended to diagnose, treat, cure, or prevent any disease. Use must comply with all applicable laws and regulations.
NEO –
High quality product. Felt like my defences were stronger during a hectic month.
Crt79 –
No complaints here
Pure for sure! noticed benefits fairly quick
Customer428 –
.
Ryan –
Interesting peptide
Seems to genuinely support the immune system, kind of like a natural defence molecule. I’ve noticed I recover faster from little things like colds or fatigue, and overall just feel more resilient. It’s not some instant miracle, but after a couple of weeks it’s clear this stuff actually does something.