LL-37 5mg – High-Purity Antimicrobial Research Peptide
LL-37 (also known as CAP-18) is a synthetic antimicrobial peptide belonging to the cathelicidin family, widely studied in preclinical research for its immune-modulating, antibacterial, antiviral, and tissue-repair properties. Supplied in lyophilised (freeze-dried) form for maximum stability, this compound is verified at >99.1% purity (HPLC-tested) and includes a full Certificate of Analysis (COA).
What is LL-37?
LL-37 is a naturally occurring peptide fragment derived from the human cathelicidin antimicrobial protein (hCAP-18). Researchers have investigated LL-37 for its role in innate immunity, inflammation regulation, and cellular regeneration.
Bluewell Peptides supplies LL-37 strictly for laboratory research use only, ensuring each batch is tested and verified for purity, stability, and composition transparency.
Scientific Identifiers
Product Name: LL-37 5mg
Catalogue Number: BWP-LL37-5
CAS Number: 154947-66-7
Molecular Formula: C₂₀₃H₃₄₅N₆₁O₄₉S
Molecular Weight: 4493.34 g/mol
Sequence: [LL-37, 37 aa]
Form: Lyophilised Solid
Purity: >99.1% (HPLC Verified)
Storage: Store at −20°C, protected from light
Unit Size: 5mg
Usage and Reconstitution
LL-37 is supplied as a lyophilised solid for stability during storage and transport. For laboratory use, it may be reconstituted with bacteriostatic water or other appropriate solvents under aseptic conditions. Refer to our peptide reconstitution page for full guidance.
Research Applications of LL-37
LL-37 has been investigated in preclinical studies for its potential influence on:
Antimicrobial Defence – Studied for its broad-spectrum antibacterial, antiviral, and antifungal properties.
Wound Healing and Tissue Repair – Explored for its potential to stimulate angiogenesis and cellular regeneration.
Immune Regulation – Researched for its ability to modulate inflammatory pathways and immune cell recruitment.
Cancer and Regenerative Studies – Investigated for its potential role in tumour suppression and tissue regeneration models.
References available upon request or via our research archive.
Why Order LL-37 from Bluewell Peptides?
99.1% purity, HPLC-verified
COA provided with every batch
Secure ordering and fast UK delivery
Transparent, research-focused supplier
Excellent customer support and trusted reviews
Legal and Safety Information
Bluewell Peptides products are supplied strictly for laboratory research and educational purposes only. They are not approved for human or veterinary use. These compounds are not intended to diagnose, treat, cure, or prevent any disease. Use must comply with all applicable laws and regulations.







NEO –
Crt79 –
Customer428 –
Ryan –